PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00026330001
Common NameGSBRNA2T00026330001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 438aa    MW: 48633 Da    PI: 5.6956
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00026330001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.98.6e-32226280155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kpr+rWtpeLHe+F++ v++L G+ekAtPk++l+lm+v+gLt++hvkSHLQkYRl
  GSBRNA2T00026330001 226 KPRMRWTPELHESFLNSVNKLEGPEKATPKAVLKLMNVEGLTIYHVKSHLQKYRL 280
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.4E-30224281IPR009057Homeodomain-like
SuperFamilySSF466898.6E-17225280IPR009057Homeodomain-like
TIGRFAMsTIGR015573.8E-24226281IPR006447Myb domain, plants
PfamPF002493.4E-8228279IPR001005SANT/Myb domain
PfamPF143795.5E-22316362IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
MNSHRLVSTA QEECNKGIQK ACSSSLSPAY NFLNVQPETT RKSPFIRSQP PDWPKNSTFS  60
RSSTFCTNLY SSSSSANETK KHLGNSLPFL PDPSASASGV ESARSPSVFS EDLGNPFDGD  120
NNSSLVKDFF NLSAEACSNG GYHDLDCSND SLSDQLELQF LSDELELAIT DRAETPRLDE  180
IYENPLASPI PVTVLSPSQR CDAGAMSIDP VSPHPSPRSA AAANQKPRMR WTPELHESFL  240
NSVNKLEGPE KATPKAVLKL MNVEGLTIYH VKSHLQKYRL AKYMPEKKEA KKNVNSEEKK  300
LALSNSEADE KKKGAIQLTE ALRMQMEVQK QLHEQLEVQR VLQLRIEEHA KYLEKMLEEQ  360
RKAGRLFSSS SSSQTLLSPS DDETRPDSQN MSKTEASLPQ PSSSAKHIAS ETEDDQCESP  420
QKRRRLENST EPQDSER*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1421425KRRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00026330001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1278610.0EF127861.1 Brassica rapa subsp. chinensis MYBogu mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013647182.10.0PREDICTED: uncharacterized protein LOC106352023 isoform X2
RefseqXP_013647189.10.0PREDICTED: uncharacterized protein LOC106352023 isoform X2
TrEMBLA0A078GFT20.0A0A078GFT2_BRANA; BnaC01g38060D protein
STRINGBra039364.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67862744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.20.0G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]